Katyperryfragrances.com

Killer Queen, the new perfume by Katy Perry, has a playful scent fit for royalty.

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Katyperryfragrances.com Domain Statistics

Title:
Katy Perry Official Killer Queen Fragrance
Description:
Killer Queen, the new perfume by Katy Perry, has a playful scent fit for royalty.
Website Topics:
SEO score:
23%
Website Worth:
$3,471 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Webstatsdomain backlinks:
IP-address:
151.101.65.6
Pageviews per User:
3
Average Time on Site:
00:48
Search Percent:
Estimated percentage of visits to katyperryfragrances.com that came from a search engine
8.3%
Bounce:
Estimated percentage of visits to katyperryfragrances.com that consist of a single pageview
58.3%
Daily Pageviews:
n\a
Sites redirect to this site:
katyperryparfum.com, www.katyperyfragrance.com
Load Time:
0.13 seconds
advertising

Katyperryfragrances.com competitors

 

Katy Perry Official Store | Shop Katy Perry Merchandise

Welcome to the katy perry official store! shop for katy perry merchandise including bon appetit

| | katyperrymerch.com

 

Katy Perry Daily Connecting Katycats Around The World!

A fansite about american singer and songwriter katy perry

| | katy-perry.com

 

Home - Katy Perry Pictures | Part of Katy Perry Now

A fan blog dedicated to single katy perry, serving all katycats with all the recent news

| | katypictures.org

 

Katy Perry + Katyperrydaily.net - Your Ultimate Katy Perry Fansite...

Katy perry made her appearance as musical guest on saturday night live on may 20

| | www.katyperrydaily.net

 

Katy Perry | Fans, Club, Join, Official, Pictures, Website, Fansite...

Everything katy perry. A resource by fans, updated by fans, and enjoyed by fans the world over

| | www.katyperryfans.co.uk

 

Katy Perry Tour 2015 | Katy Perry Tickets 2015

Katy perry tour 2015, don't miss the show.grab your katy perry tickets and see katy perry live on tour in 2015

| | katyperrytour.net

 

Katy Perry

The official website of katy perry.new album 'prism' coming october 22, 2013! featuring the singleroar!

| | www.katyperry.com

 

New Songs 2015 Katy Perry Jason Derulo Onerepublic Iggy Azalea Arianagrande...

Katy perry, jason derulo, onerepublic, iggy azalea, ariana grande, pharrell williams, lorde, chris brown

| | www.newsongsof2015.com

 

The Official Website of Queen's Athletics & Recreation

The official website of queen's university athletics & recreation

| | www.gogaelsgo.com

Katyperryfragrances.com Sites with a similar domain name

We found 17 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Site Not Found · Dreamhost

The owner of this domain has not yet uploaded their website

| | katyperryforum.com

 

Katy Perry | Fans, Club, Join, Official, Pictures, Website, Fansite...

Everything katy perry. A resource by fans, updated by fans, and enjoyed by fans the world over

| | katyperryfans.co.uk

 

Katy Perry

I kissed a girl

| | katyperryfan.info

 

Katyperryfragrancesweepstakes.com

| | katyperryfragrancesweepstakes.com

 

Katyperryfans.org

| | katyperryfans.org

 

Katyperryfourm.com

| | katyperryfourm.com

 

Katyperryfireworklyrics.com

| | katyperryfireworklyrics.com

 

Katy Perry Firework

| | katyperryfirework.info

 

Katyperryfansite.com

| | katyperryfansite.com

 

Katy Perry Fireworks

Katy perry has taken the entertainment world by storm! her unique style and taboo lyrics have landed her a spot as the pop princess!

| | katyperryfirework.net

 

Katyperryfanclub.com Domain Name is For Sale. Inquire Now.

Katyperryfanclub.com is available for purchase. Get in touch to discuss the possibilities!

| | katyperryfanclub.com

 

Истек Срок Регистрации Домена Katyperryfans.ru

Рады приветствовать вас на фан-сайте певицы кэти перри! вступайте в наше сообщество и будьте вкурсе самых свежих новостей леди перри

| | katyperryfans.ru

 

Katy Perry Fan Club – Page 1

(here to see the dates) katycat(s) online since september 2010

| | katyperryfanclub.it

 

Katy Perry Fan Club | Beverly Hills

International fan club for fans of the worlds biggest pop idol - katy perry!

| | katyperryfan.org

 

Katyperryfanclub.tv

| | katyperryfanclub.tv

Katyperryfragrances.com Contact information :

http://www.coty.com/contact - Contact | Coty
Facebook profile for katyperryfragrances.com - Katy Perry Fragrances | Facebook
@katyperry - KATY PERRY (@katyperry) | Twitter
See katyperryfragrances.com contact information in whois record

Web Safety

katyperryfragrances.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Katyperryfragrances.com Visitors Localization

Traffic Estimations Low
Traffic Rank 974,634th most visited website in the World

Website categories

Currently, we found 3 categories on katyperryfragrances.com
katy perry 4'304 sites celebrity 32'066 sites
katy 5'266 sites

Katyperryfragrances.com Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
perfume de katy perry
1 2015-12-31
katy perry perfume
1 2015-12-30
queen killer queen youtube
3 2016-02-09
new katy perry
5 2016-01-24
katy perry meow
10 2015-12-31
new parfums
12 2016-01-03
contact katy perry
13 2015-12-08
amber purr
18 2015-12-09
katy perry website
19 2015-12-09
coty fragrance
20 2015-12-08

Katyperryfragrances.com Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

Your site has high probability to get under the filter Google, which called Google penguin.

  • explore the scent ( 100% )

Katyperryfragrances.com Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • explore( 50% )
  • scent( 50% )

Katyperryfragrances.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.13. The highest load time is 0.49, the lowest load time is 0.13, the average load time is 0.30.

Whois Lookup For katyperryfragrances.com

0reviews

Add review