Katyperryfragrances.com
Killer Queen, the new perfume by Katy Perry, has a playful scent fit for royalty.
Katyperryfragrances.com Domain Statistics
Katyperryfragrances.com competitors
Katy Perry Official Store | Shop Katy Perry Merchandise
Welcome to the katy perry official store! shop for katy perry merchandise including bon appetit
| | katyperrymerch.com
Katy Perry Daily Connecting Katycats Around The World!
A fansite about american singer and songwriter katy perry
| | katy-perry.com
Home - Katy Perry Pictures | Part of Katy Perry Now
A fan blog dedicated to single katy perry, serving all katycats with all the recent news
| | katypictures.org
Katy Perry + Katyperrydaily.net - Your Ultimate Katy Perry Fansite...
Katy perry made her appearance as musical guest on saturday night live on may 20
| | www.katyperrydaily.net
Katy Perry | Fans, Club, Join, Official, Pictures, Website, Fansite...
Everything katy perry. A resource by fans, updated by fans, and enjoyed by fans the world over
| | www.katyperryfans.co.uk
Katy Perry Tour 2015 | Katy Perry Tickets 2015
Katy perry tour 2015, don't miss the show.grab your katy perry tickets and see katy perry live on tour in 2015
| | katyperrytour.net
Katy Perry
The official website of katy perry.new album 'prism' coming october 22, 2013! featuring the singleroar!
| | www.katyperry.com
New Songs 2015 Katy Perry Jason Derulo Onerepublic Iggy Azalea Arianagrande...
Katy perry, jason derulo, onerepublic, iggy azalea, ariana grande, pharrell williams, lorde, chris brown
| | www.newsongsof2015.com
The Official Website of Queen's Athletics & Recreation
The official website of queen's university athletics & recreation
| | www.gogaelsgo.com
Katyperryfragrances.com Sites with a similar domain name
We found 17 websites. With this list, you can understand how other people are using the domain, similar to yours.
Site Not Found · Dreamhost
The owner of this domain has not yet uploaded their website
| | katyperryforum.com
Katy Perry | Fans, Club, Join, Official, Pictures, Website, Fansite...
Everything katy perry. A resource by fans, updated by fans, and enjoyed by fans the world over
| | katyperryfans.co.uk
Katy Perry
I kissed a girl
| | katyperryfan.info
Katyperryfragrancesweepstakes.com
| | katyperryfragrancesweepstakes.com
Katyperryfans.org
| | katyperryfans.org
Katyperryfourm.com
| | katyperryfourm.com
Katyperryfireworklyrics.com
| | katyperryfireworklyrics.com
Katy Perry Firework
| | katyperryfirework.info
Katyperryfansite.com
| | katyperryfansite.com
Katy Perry Fireworks
Katy perry has taken the entertainment world by storm! her unique style and taboo lyrics have landed her a spot as the pop princess!
| | katyperryfirework.net
Katyperryfanclub.com Domain Name is For Sale. Inquire Now.
Katyperryfanclub.com is available for purchase. Get in touch to discuss the possibilities!
| | katyperryfanclub.com
Истек Срок Регистрации Домена Katyperryfans.ru
Рады приветствовать вас на фан-сайте певицы кэти перри! вступайте в наше сообщество и будьте вкурсе самых свежих новостей леди перри
| | katyperryfans.ru
Katy Perry Fan Club – Page 1
(here to see the dates) katycat(s) online since september 2010
| | katyperryfanclub.it
Katy Perry Fan Club | Beverly Hills
International fan club for fans of the worlds biggest pop idol - katy perry!
| | katyperryfan.org
Katyperryfanclub.tv
| | katyperryfanclub.tv
Hugedomains.com - Katyperryfirework.com is For Sale (katy Perry Firework)...
| | katyperryfirework.com
Фан-клуб Кэти Перри
| | katyperryfan.ru
Katyperryfragrances.com Contact information :
http://www.coty.com/contact - Contact | Coty |
Facebook profile for katyperryfragrances.com - Katy Perry Fragrances | Facebook |
@katyperry - KATY PERRY (@katyperry) | Twitter |
See katyperryfragrances.com contact information in whois record |
Web Safety
katyperryfragrances.com is
website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.Is Katyperryfragrances.com Legal or Not
URLs Requested to be Removed: | 0 |
---|---|
Urls removed: | 0 |
Percent: | 0% |
Summary: | Katyperryfragrances.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Katyperryfragrances.com Visitors Localization
Traffic Estimations | |
---|---|
Traffic Rank | 974,634th most visited website in the World |
Website categories
katy perry 4'304 sites | celebrity 32'066 sites |
katy 5'266 sites |
Katyperryfragrances.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
Keyword | Position | Date |
---|---|---|
perfume de katy perry | 1 | 2015-12-31 |
katy perry perfume | 1 | 2015-12-30 |
queen killer queen youtube | 3 | 2016-02-09 |
new katy perry | 5 | 2016-01-24 |
katy perry meow | 10 | 2015-12-31 |
new parfums | 12 | 2016-01-03 |
contact katy perry | 13 | 2015-12-08 |
amber purr | 18 | 2015-12-09 |
katy perry website | 19 | 2015-12-09 |
coty fragrance | 20 | 2015-12-08 |
Katyperryfragrances.com Backlinks History
At the last check on 2018-08-14, we found 4 backlinks. The highest value is 4, the lowest value is 4, the average is 4.
Katyperryfragrances.com Anchors Cloud
Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"
Katyperryfragrances.com Terms Cloud
List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"
- explore( 50% )
- scent( 50% )
Katyperryfragrances.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.13. The highest load time is 0.49, the lowest load time is 0.13, the average load time is 0.30.